Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dipeptide transport system permease protein dppC (dppC)

This Recombinant Dipeptide transport system permease protein dppC (dppC) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Dipeptide transport system permease protein dppC

UniProt

P0AEG3

Expression Region

1-300

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQVTENKVISAPVPMTPLQEFWHYFKRNKGAVVGLVYVVIVLFIAIFANWIAPYNPAEQ FRDALLAPPAWQEGGSMAHLLGTDDVGRDVLSRLMYGARLSLLVGCLVVVLSLIMGVILG LIAGYFGGLVDNIIMRVVDIMLALPSLLLALVLVAIFGPSIGNAALALTFVALPHYVRLT RAAVLVEVNRDYVTASRVAGAGAMRQMFINIFPNCLAPLIVQASLGFSNAILDMAALGFL GMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKLKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MASA (ENOPH1) Mouse Monoclonal Antibody [Clone ID: OTI4E1]
CF810868 100 µg

MASA (ENOPH1) Mouse Monoclonal Antibody [Clone ID: OTI4E1]

Sign In for Pricing
View Details
Tbc1d15 Mouse Gene Knockout Kit (CRISPR)
KN517240 1 Kit

Tbc1d15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Protein Kinase D2 (PRKD2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B12]
TA501775AM 100 µL

Protein Kinase D2 (PRKD2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B12]

Sign In for Pricing
View Details
TMEM45A Rabbit Polyclonal Antibody
TA372474 100 µL

TMEM45A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mini Sample Mouse TNF-α (Tumor Necrosis Factor Alpha) ELISA Kit
E-MSEL-M0002-01 10x 96 Tests

Mini Sample Mouse TNF-α (Tumor Necrosis Factor Alpha) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse TNF-α (Tumor Necrosis Factor Alpha) ELISA Kit
E-MSEL-M0002-02 5x 96 Tests

Mini Sample Mouse TNF-α (Tumor Necrosis Factor Alpha) ELISA Kit

Sign In for Pricing
View Details