Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dipeptide transport system permease protein dppC (dppC)

This Recombinant Dipeptide transport system permease protein dppC (dppC) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Dipeptide transport system permease protein dppC

UniProt

P0AEG3

Expression Region

1-300

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQVTENKVISAPVPMTPLQEFWHYFKRNKGAVVGLVYVVIVLFIAIFANWIAPYNPAEQ FRDALLAPPAWQEGGSMAHLLGTDDVGRDVLSRLMYGARLSLLVGCLVVVLSLIMGVILG LIAGYFGGLVDNIIMRVVDIMLALPSLLLALVLVAIFGPSIGNAALALTFVALPHYVRLT RAAVLVEVNRDYVTASRVAGAGAMRQMFINIFPNCLAPLIVQASLGFSNAILDMAALGFL GMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKLKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK5 Human Gene Knockout Kit (CRISPR)
KN209137 1 Kit

GRK5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/1766R), CF647 conjugate, 0.1mg/mL
BNC471766-100 1x 100 µL

CD43 (T-Cell Marker) (SPN/1766R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF568 conjugate, 0.1mg/mL
BNC682988-500 1x 500 µL

BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Mouse SELE (E-selectin) ELISA Kit
E-UNEL-M0014-01 5x 96 Tests

Uncoated Mouse SELE (E-selectin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse SELE (E-selectin) ELISA Kit
E-UNEL-M0014-02 15x 96 Tests

Uncoated Mouse SELE (E-selectin) ELISA Kit

Sign In for Pricing
View Details
CD64 (10.1), CF405S conjugate, 0.1mg/mL
BNC042846-500 1x 500 µL

CD64 (10.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details