Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudoalteromonas haloplanktis UPF0761 membrane protein PSHAa0171 (PSHAa0171)

This Recombinant Pseudoalteromonas haloplanktis UPF0761 membrane protein PSHAa0171 (PSHAa0171) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

UPF0761 membrane protein PSHAa0171

UniProt

Q3IJ43

Expression Region

1-300

Origin

Pseudoalteromonas haloplanktis (strain TAC 125)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDKLSYYKQQVGSFLRQQPGWWMQYINRCIDDQITVNAGYLAYVTLLSLVPLIAVGVAI FSAFPGFESTRLAIESFLFTNFVPTSSDVIKEHISSFAGNANQMTAVGIGFLAAIALLLI RNVDATLNRIWRIKKKRPMMISFAVYWMVLSLGPVFLGGSIAVTSYIVSLVSFADQGIPG FSGFLLKLLPYGISMVGFIMLYTLVPNTRVSFKAAIPGALFAAMLFELTKKGFALYISHF PSYEVIYGAVATIPILFVWIYLSWIVVLLGAELTACISPENIEDTPEIELDEQENTKDTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL
BNC940977-100 1x 100 µL

TGF-beta (1D11.16.8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-500 1x 500 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL
BNC040977-500 1x 500 µL

TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-100 1x 100 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details