Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Probable mitochondrial 2-oxodicarboxylate carrier (mcfT)

This Recombinant Dictyostelium discoideum Probable mitochondrial 2-oxodicarboxylate carrier (mcfT) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Probable mitochondrial 2-oxodicarboxylate carrier, Solute carrier family 25 member 21

UniProt

Q55GE2

Expression Region

1-300

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSKGNAGNPPTPTPAPVKSQPLWHNLVSGGIAGVSEILVMYPLDVVKTRQQLQVGKGQS MMSSLVTMVRHDGLKMYRGIVPPILVEAPKRAIKFASNKFYEKQILSYCGNTKPTQMQAI GSGVLAGITEAFIVVPFELVKIRLQAKENAGKYTSTMDCVNKTFRAEGLSGFFKGLESTI WRHACWNGGYFGLIHTIKSALPKPTTEQGVLVNNFIAGGLAGTFGTMLNTPADVVKSRIQ NQVGAGKYNWCIPSILTVAREEGFSALYKGFLPKVLRLGPGGGILLVVNEFVMKLLAGKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-100 1x 100 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-100 1x 100 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-100 1x 100 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details