Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cation-efflux pump FieF (fieF)

This Recombinant Cation-efflux pump FieF (fieF) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Cation-efflux pump FieF

UniProt

Q8RR17

Expression Region

1-300

Origin

Klebsiella pneumoniae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQSYGRLVSRAAIAATAMASALLLIKIFAWWYTGSVSILAALVDSLVDIAASLTNLLVV RYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGIQHLVRPEPLQAAGVGVVV TLIALVSTLALVTFQRWVVRKTQSQAVRADMLHYQSDVMMNGAILVALGLSWYGWHRADA LFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQDIITIVTAWPGIRGAHDLRTRQSG PTRFIQIHLEMEDNLPLVQAHVIADQVEQAILRRFPGSDVIIHQDPSSVVPAAQQGFFER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-100 1x 100 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-500 1x 500 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-500 1x 500 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2098), CF647 conjugate, 0.1mg/mL
BNC472098-100 1x 100 µL

Catenin, beta (CTNNB1) (CTNNB1/2098), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-100 1x 100 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), CF640R conjugate, 0.1mg/mL
BNC400752-100 1x 100 µL

Bcl-x (BX006 + 2H12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details