Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cation-efflux pump FieF (fieF)

This Recombinant Cation-efflux pump FieF (fieF) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Cation-efflux pump FieF

UniProt

Q8ZJL7

Expression Region

1-300

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQYARWVKAAALSATALASILLIIKIFAWWHTGSVSLLAALVDSLVDLAASLTNLFVV RYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGFRHLASPEPLQDPSIGIGV TLVALFSTLILVTFQRWVVRKTHSQAIRADMLHYQSDVLMNGAILIALALSWYGFRRADA LFALGIGVYILYSALRMGYEAVQSLLDRALPDDERQQIIDIVTSWPGVIGAHDLRTRRSG QTRFIQLHLEMEDMMPLMEAHVLAEQVEHALLYRFPGADVLIHQDPCSVVPKERHAHWEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-100 1x 100 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-100 1x 100 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (RT-97), CF647 conjugate, 0.1mg/mL
BNC470454-500 1x 500 µL

Neurofilament (NF-H) (RT-97), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF740 conjugate, 0.1mg/mL
BNC741388-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF594 conjugate, 0.1mg/mL
BNC942110-100 1x 100 µL

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (CNN1/832), CF640R conjugate, 0.1mg/mL
BNC400832-100 1x 100 µL

Calponin-1 (CNN1/832), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details