Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstA 2 (pstA2)

This Recombinant Phosphate transport system permease protein pstA 2 (pstA2) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA 2

UniProt

P0A627

Expression Region

1-301

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGESAESGSRQLPAMSPPRRSVAYRRKIVDALWWAACVCCLAVVITPTLWMLIGVVSRAV PVFHWSVLVQDSQGNGGGLRNAIIGTAVLAIGVILVGGTVSVLTGIYLSEFATGKTRSIL RGAYEVLSGIPSIVLGYVGYLALVVYFDWGFSLAAGVLVLSVMSIPYIAKATESALAQVP TSYREAAEALGLPAGWALRKIVLKTAMPGIVTGMLVALALAIGETAPLLYTAGWSNSPPT GQLTDSPVGYLTYPIWTFYNQPSKSAQDLSYDAALLLIVFLLLLIFIGRLINWLSRRRWD V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (Follicular Dendritic Cell Marker) (To5), CF647 conjugate, 0.1mg/mL
BNC471318-500 1x 500 µL

CD35 / CR1 (Follicular Dendritic Cell Marker) (To5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human TNFRSF1B/CD120b Protein (His & Fc Tag)
PKSH031618 100 µg

Recombinant Human TNFRSF1B/CD120b Protein (His & Fc Tag)

Sign In for Pricing
View Details
GGCX (NM_000821) Human Over-expression Lysate
LY400291 100 µg

GGCX (NM_000821) Human Over-expression Lysate

Sign In for Pricing
View Details
8-Anilino-1-naphthalenesulfonic Acid Hemimagnesium Salt
TRC-A663798-5G 5 g

8-Anilino-1-naphthalenesulfonic Acid Hemimagnesium Salt

Sign In for Pricing
View Details
APC Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823E-01 25 µg

APC Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
APC Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09823E-02 100 µg

APC Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details