Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstA 2 (pstA2)

This Recombinant Phosphate transport system permease protein pstA 2 (pstA2) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA 2

UniProt

P0A627

Expression Region

1-301

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGESAESGSRQLPAMSPPRRSVAYRRKIVDALWWAACVCCLAVVITPTLWMLIGVVSRAV PVFHWSVLVQDSQGNGGGLRNAIIGTAVLAIGVILVGGTVSVLTGIYLSEFATGKTRSIL RGAYEVLSGIPSIVLGYVGYLALVVYFDWGFSLAAGVLVLSVMSIPYIAKATESALAQVP TSYREAAEALGLPAGWALRKIVLKTAMPGIVTGMLVALALAIGETAPLLYTAGWSNSPPT GQLTDSPVGYLTYPIWTFYNQPSKSAQDLSYDAALLLIVFLLLLIFIGRLINWLSRRRWD V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Iodo-D-tyrosine
TRC-I819608-250MG 250 mg

3-Iodo-D-tyrosine

Sign In for Pricing
View Details
Mouse Uchl5 activation kit by CRISPRa
GA205859 1 Kit

Mouse Uchl5 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS630449 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Mouse Gm14288 activation kit by CRISPRa
GA201306 1 Kit

Mouse Gm14288 activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Conjugated Dolichos biflorus Lectin (Horse Gram) -DBA-
F-1201-2 2 mg

FITC Conjugated Dolichos biflorus Lectin (Horse Gram) -DBA-

Sign In for Pricing
View Details
Recombinant Niemann Pick C1 Like 1 Antibody
RC-16898-01 50 μL

Recombinant Niemann Pick C1 Like 1 Antibody

Sign In for Pricing
View Details