Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstA 2 (pstA2)

This Recombinant Phosphate transport system permease protein pstA 2 (pstA2) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA 2

UniProt

P0A626

Expression Region

1-301

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGESAESGSRQLPAMSPPRRSVAYRRKIVDALWWAACVCCLAVVITPTLWMLIGVVSRAV PVFHWSVLVQDSQGNGGGLRNAIIGTAVLAIGVILVGGTVSVLTGIYLSEFATGKTRSIL RGAYEVLSGIPSIVLGYVGYLALVVYFDWGFSLAAGVLVLSVMSIPYIAKATESALAQVP TSYREAAEALGLPAGWALRKIVLKTAMPGIVTGMLVALALAIGETAPLLYTAGWSNSPPT GQLTDSPVGYLTYPIWTFYNQPSKSAQDLSYDAALLLIVFLLLLIFIGRLINWLSRRRWD V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HSD3B1 Antibody
RC-15021-01 50 μL

Recombinant HSD3B1 Antibody

Sign In for Pricing
View Details
Recombinant HSD3B1 Antibody
RC-15021-02 100 µL

Recombinant HSD3B1 Antibody

Sign In for Pricing
View Details
Recombinant HSD3B1 Antibody
RC-15021-03 1 mL

Recombinant HSD3B1 Antibody

Sign In for Pricing
View Details
Mup1 (NM_031188) Mouse Tagged ORF Clone
MG201618 10 µg

Mup1 (NM_031188) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD30 (TNFRSF8) Mouse Monoclonal Antibody [Clone ID: Ber-H8]
AM26799RP-N 100 Tests

CD30 (TNFRSF8) Mouse Monoclonal Antibody [Clone ID: Ber-H8]

Sign In for Pricing
View Details
LZTR1 Rabbit Polyclonal Antibody
TA378187 100 µL

LZTR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details