Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstA 2 (pstA2)

This Recombinant Phosphate transport system permease protein pstA 2 (pstA2) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA 2

UniProt

P0A626

Expression Region

1-301

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGESAESGSRQLPAMSPPRRSVAYRRKIVDALWWAACVCCLAVVITPTLWMLIGVVSRAV PVFHWSVLVQDSQGNGGGLRNAIIGTAVLAIGVILVGGTVSVLTGIYLSEFATGKTRSIL RGAYEVLSGIPSIVLGYVGYLALVVYFDWGFSLAAGVLVLSVMSIPYIAKATESALAQVP TSYREAAEALGLPAGWALRKIVLKTAMPGIVTGMLVALALAIGETAPLLYTAGWSNSPPT GQLTDSPVGYLTYPIWTFYNQPSKSAQDLSYDAALLLIVFLLLLIFIGRLINWLSRRRWD V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Disperse Red 60 (Technical Grade)
TRC-D014960-250MG 250 mg

Disperse Red 60 (Technical Grade)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS704892 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2425), CF640R conjugate, 0.1mg/mL
BNC402425-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2425), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
10X Buffer V1, 5 x 1ml
RB0208 5x 1 mL

10X Buffer V1, 5 x 1ml

Sign In for Pricing
View Details
NF-kappaB p105/p50 Mouse Monoclonal Antibody [A2-7]
M1505-8 100 µL

NF-kappaB p105/p50 Mouse Monoclonal Antibody [A2-7]

Sign In for Pricing
View Details
LZIC Antibody
KC-33460-01 50 μL

LZIC Antibody

Sign In for Pricing
View Details