Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phosphate transport system permease protein pstA 2 (pstA2)

This Recombinant Phosphate transport system permease protein pstA 2 (pstA2) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA 2

UniProt

P0A626

Expression Region

1-301

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGESAESGSRQLPAMSPPRRSVAYRRKIVDALWWAACVCCLAVVITPTLWMLIGVVSRAV PVFHWSVLVQDSQGNGGGLRNAIIGTAVLAIGVILVGGTVSVLTGIYLSEFATGKTRSIL RGAYEVLSGIPSIVLGYVGYLALVVYFDWGFSLAAGVLVLSVMSIPYIAKATESALAQVP TSYREAAEALGLPAGWALRKIVLKTAMPGIVTGMLVALALAIGETAPLLYTAGWSNSPPT GQLTDSPVGYLTYPIWTFYNQPSKSAQDLSYDAALLLIVFLLLLIFIGRLINWLSRRRWD V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General Purpose Incubator BIGP-6901
BIGP-6901 1 Unit

General Purpose Incubator BIGP-6901

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG Total MK1A6,  15nm
GM-210-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG Total MK1A6, 15nm

Sign In for Pricing
View Details
p38 (MAPK14) pTyr182 Rabbit Polyclonal Antibody
AP20851PU-N 100 µg

p38 (MAPK14) pTyr182 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human FAM190A (CCSER1) activation kit by CRISPRa
GA118312 1 Kit

Human FAM190A (CCSER1) activation kit by CRISPRa

Sign In for Pricing
View Details
Synaptotagmin 1 (SYT1) (NM_001135805) Human Recombinant Protein
TP327105M 100 µg

Synaptotagmin 1 (SYT1) (NM_001135805) Human Recombinant Protein

Sign In for Pricing
View Details
HNRNPD (NM_002138) Human Recombinant Protein
TP760280 50 µg

HNRNPD (NM_002138) Human Recombinant Protein

Sign In for Pricing
View Details