Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermodesulfovibrio yellowstonii Protein translocase subunit SecF (secF)

This Recombinant Thermodesulfovibrio yellowstonii Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

B5YIG8

Expression Region

1-301

Origin

Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQILGKTNIDFLGKKYIALALSCIMIILGIFAIFQIHAGKANLGVDFAGGLSLQIRFSQ PVTLAEVRTVLDKAGIKDADIQELPTEKKILIKLKKQQEGIQDTIEKALKENLTAKEPII ESVTEIGPKIGERTKRDALFAILAATAGILIYIAIRFKFHFSIGATVATFHDVMAVLGIF YILDKEINLIFISALLTIAGYSLTDTVVVFDRIRENLGKVAKGTMTLEALMNKSINEVLS RTIVTSLTTLMAAVALFFFGGEVLHDFALAMILGILVGTYSSIFVASPVVLLLGKNSLIK R

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-100 1x 100 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-100 1x 100 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-500 1x 500 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-500 1x 500 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3 + CA72/733), CF568 conjugate, 0.1mg/mL
BNC680734-100 1x 100 µL

TAG-72 / CA72.4 (B72.3 + CA72/733), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF640R conjugate, 0.1mg/mL
BNC400418-500 1x 500 µL

Fascin-1 (FSCN1/418), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details