Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Petrotoga mobilis Protein translocase subunit SecF (secF)

This Recombinant Petrotoga mobilis Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

A9BG78

Expression Region

1-302

Origin

Petrotoga mobilis (strain DSM 10674 / SJ95)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPNIDFVGKRSFFIYLSIALILFSVIVIFVKGFNLGVDFSGGSEIIVSFDKSYTIDELRN GLQTINQEYATAKIIQTNPGGGASDQFFYIITVRDSFPTLEEKQMFINSLEESFSDSSLN IEQFNDVSGYAAREIRSYAWYAVIISLIVLLAYITIRFQFSYGVGAILALAHDVIITLGF YSLFGIEMNLTAIAAFLTLAGYSLNDTIVVYDRIRENRSKNRGMDIESITNKSINEVIVR SLNTSLTTFLVVFMMFLLGGRSIASFAFGLTVGVIIGTYSSLYIASPIVIGMVKRRKKTQ KA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-100 1x 100 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (C6/372 + 3F7B5), CF640R conjugate, 0.1mg/mL
BNC401228-100 1x 100 µL

CD6 (C6/372 + 3F7B5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SM1/495), CF568 conjugate, 0.1mg/mL
BNC680495-100 1x 100 µL

SUMO-1 (SM1/495), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details