Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative ABC transporter permease protein AmyD (amyD)

This Recombinant Bacillus subtilis Putative ABC transporter permease protein AmyD (amyD) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Putative ABC transporter permease protein AmyD

UniProt

O34706

Expression Region

1-303

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIARDVHVKQVKPKKQSSLWWMYIPALLSVLVFMIYPFVKGTLITFTNWNGFSQVYQW VGFAQYERLFSDPDTWHILKNTLHYGLGSTFFQNVVGLLYALLLNQSIKTKAVTRTIVYL PVMISPLIMGYIWYFFFSYDGGALNDLLGVFGISPINALASPSLNPWIIVMINTYQYVGI AMVVYLAGLQSIPKDYYEAAQMDGAKQGQQFFTITLPLLMPSITINIVINIIGGLKLFDV IIALTAGGPGNASQSMSTFMYDLYFKRQDAGYAATQGIFMAFVILIISFCALAYFKRKET EMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPHK1 Human qPCR Primer Pair (NM_182965)
HP233366 200 Reactions

SPHK1 Human qPCR Primer Pair (NM_182965)

Sign In for Pricing
View Details
Anti-NFKB3
Y058181 100 µL

Anti-NFKB3

Sign In for Pricing
View Details
Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3351), Biotin conjugate, 0.1mg/mL
BNCB3351-100 1x 100 µL

Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3351), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mix-n-StainTM Maxi CF®680 Antibody Labeling Kit, 1x1mg labeling
#92422 1 Kit

Mix-n-StainTM Maxi CF®680 Antibody Labeling Kit, 1x1mg labeling

Sign In for Pricing
View Details
Hexanoyl Glycine
TRC-H281200-10MG 10 mg

Hexanoyl Glycine

Sign In for Pricing
View Details
RealStar®hMPV RT-PCR Kit 2.0 RUO
252003 96 Tests

RealStar®hMPV RT-PCR Kit 2.0 RUO

Sign In for Pricing
View Details