Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maltose transport system permease protein malG (malG)

This Recombinant Maltose transport system permease protein malG (malG) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Maltose transport system permease protein malG

UniProt

Q74RF8

Expression Region

1-303

Origin

Yersinia pestis

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKEEMQMAMVQPKSQRLRLLGTHFLMLCFIALIMFPLLMVIAISLRPGNFATGSLIPDQ ISWEHWKLALGMSVTHADGSVTPPPFPVMLWLWNSIKIALITAMGIVALSTTCAYAFARM RFRGKSALLKGMLIFQMFPAVLSLVALYALFDRIGQYMPFIGLNTHGGVIFAYMGGIALH VWTIKGYFETIDNSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVA SLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITTVFLLAQRWLVGGLTAGG VKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-100 1x 100 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1148), CF488A conjugate, 0.1mg/mL
BNC881148-500 1x 500 µL

CD45RA (PTPRC/1148), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (DCS-60.2), CF405S conjugate, 0.1mg/mL
BNC040822-100 1x 100 µL

P21 / WAF1 (DCS-60.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (ECM1/792), CF405S conjugate, 0.1mg/mL
BNC040792-100 1x 100 µL

IgA Secretory Component (ECM1/792), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details