Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum ASC1-like protein

This Recombinant Solanum lycopersicum ASC1-like protein spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

ASC1-like protein, Alternaria stem canker resistance-like protein

UniProt

Q8W4Y5

Expression Region

1-303

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLLEGTFLDWEYESYPSYEDFAVLPLFALFFPSVRFLLDRFVFEKVARRLIFGKGQEVV ENETDDRRRRIRKFKESAWKCIYFLSAEVFALVVTYNEPWFTNTRYFWVGPGDQVWPDQM YKSKLKALYMYTGGFYTYSIFALIFWETRRSDFGVSMSHHVATAILIVLSYNIRFARVGS VVLAIHDASDIFLEIGKMSKYSGAEALASFRYLCLSWIILRLIYYPFWVLWSTSYEVLQT LDKEKHKVDGPIYYYIFNSLLFCLLVLHIYWWVLIYRMLVKQIQARGQLSDDVRSDSEDE HED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Diffuse Large B-Cell Lymphoma Bone Marrow Plasma (Newly Diagnosed/Untreated)
ABC-TC3405 1 Vial

Human Diffuse Large B-Cell Lymphoma Bone Marrow Plasma (Newly Diagnosed/Untreated)

Sign In for Pricing
View Details
WBSCR17 CRISPRa sgRNA lentivector (set of three targets)(Rat)
50283126 3x 1.0µg DNA

WBSCR17 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
PRKAR2B Antibody
E19-7820-1 50 µg - 50 µL

PRKAR2B Antibody

Sign In for Pricing
View Details
ACSL5 CRISPRa sgRNA lentivector (set of three targets)(Rat)
11217126 3x 1.0µg DNA

ACSL5 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
CD45RB (PD7/26) : m-IgGκ BP-HRP Bundle
sc-534079 1 Kit

CD45RB (PD7/26) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
PLA2G12A Antibody (Center)
MBS9202505-01 0.08 mL

PLA2G12A Antibody (Center)

Sign In for Pricing
View Details