Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum ASC1-like protein

This Recombinant Solanum lycopersicum ASC1-like protein spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

ASC1-like protein, Alternaria stem canker resistance-like protein

UniProt

Q8W4Y5

Expression Region

1-303

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLLEGTFLDWEYESYPSYEDFAVLPLFALFFPSVRFLLDRFVFEKVARRLIFGKGQEVV ENETDDRRRRIRKFKESAWKCIYFLSAEVFALVVTYNEPWFTNTRYFWVGPGDQVWPDQM YKSKLKALYMYTGGFYTYSIFALIFWETRRSDFGVSMSHHVATAILIVLSYNIRFARVGS VVLAIHDASDIFLEIGKMSKYSGAEALASFRYLCLSWIILRLIYYPFWVLWSTSYEVLQT LDKEKHKVDGPIYYYIFNSLLFCLLVLHIYWWVLIYRMLVKQIQARGQLSDDVRSDSEDE HED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESRRA (Steroid Hormone Receptor ERR1, Estrogen-related Receptor, alpha, ERR-alpha, Estrogen Receptor-like 1, Nuclear Receptor Subfamily 3 Group B Member 1, NR3B1, ESRL1, ERR1) (PE)
126469-PE 100 µL

ESRRA (Steroid Hormone Receptor ERR1, Estrogen-related Receptor, alpha, ERR-alpha, Estrogen Receptor-like 1, Nuclear Receptor Subfamily 3 Group B Member 1, NR3B1, ESRL1, ERR1) (PE)

Sign In for Pricing
View Details
ADCK1 Polyclonal Antibody
E44H03913 100 µL

ADCK1 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF33B Antibody
MBS859972-01 0.1 mg

ZNF33B Antibody

Sign In for Pricing
View Details
ZNF33B Antibody
MBS859972-02 0.1 mL (AF405L)

ZNF33B Antibody

Sign In for Pricing
View Details
ZNF33B Antibody
MBS859972-03 0.1 mL (AF405S)

ZNF33B Antibody

Sign In for Pricing
View Details
ZNF33B Antibody
MBS859972-04 0.1 mL (AF610)

ZNF33B Antibody

Sign In for Pricing
View Details