Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Calditerrivibrio nitroreducens Protein translocase subunit SecF (secF)

This Recombinant Calditerrivibrio nitroreducens Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

E4TJ19

Expression Region

1-304

Origin

Calditerrivibrio nitroreducens (strain DSM 19672 / NBRC 101217 / Yu37-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQFLELIKNDSNIDFLGKAKLFFIISGVLIVISLFLIFTKGLNLGIDFSGGTVIQLKYE KPADLNKLRQGIGNLKIGDVSIQNFGNPEEVLIRLGKTRDIPLEELSKTIRAKLAEIDPN NKFIVERVEQVGPQVGSELQYKAMMALLYANIGVLIYVAIRFELIFAIGAILALVHDVII TLGFLSLTSKEFNLTVVAALLALIGYSLNDTIVVFDRIRERIKATANEKINIKDIMNKSI NETLSRTIITSLLTFFTVLSLMIFGGEVINPFAFTLVIGIIVGTYSSIGIASGLVYLIKS LRKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Giardia lamblia (BB1.1E5), CF488A conjugate, 0.1mg/mL
BNC880210-500 1x 500 µL

Giardia lamblia (BB1.1E5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Antithrombin-III/AT3 protein (His tag)
PDMH100092-01 20 µg

Recombinant Human Antithrombin-III/AT3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Antithrombin-III/AT3 protein (His tag)
PDMH100092-02 100 µg

Recombinant Human Antithrombin-III/AT3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Antithrombin-III/AT3 protein (His tag)
PDMH100092-03 500 µg

Recombinant Human Antithrombin-III/AT3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human Antithrombin-III/AT3 protein (His tag)
PDMH100092-04 1 mg

Recombinant Human Antithrombin-III/AT3 protein (His tag)

Sign In for Pricing
View Details
Ccnf Mouse Gene Knockout Kit (CRISPR)
KN502815 1 Kit

Ccnf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details