Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Turkey astrovirus 1 Non-structural polyprotein 1A (ORF1)

This Recombinant Turkey astrovirus 1 Non-structural polyprotein 1A (ORF1) spans the amino acid sequence from region 796-1099.

Product Specifications

Product Name Alternative

Non-structural polyprotein 1A, Cleaved into the following 4 chains:, 1. Protein p19, 2. Transmembrane protein 1A, 3. Serine protease p27, 4. p27, EC= 5. 3.4.21.-, 6. Protein p20'

UniProt

Q9JH70

Expression Region

796-1099

Origin

Turkey astrovirus 1 (TAstV-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KKKGKTKRTARGGKHALGKKYLSKAHFSRMRMLTEEEYNKMVEDGFSPDEIKEVVDQLRE QAWQNYLIDNDIGEDDDLDWYDDMLEDERLNEEIDRRVEAALEDRGELAYQKIRRTFVDQ ALIHLITLKKGNWQTTKVECQPEREEAYKEQFQKAVKQEDLTEGTSYAIYSAGDATILIE NKEIDHTEIKPVTTGAKTVQEYPKDARTTVATFDDNKKDIVKTKRTTEIVLEQRKKTCRT CGETRPHNHKMCRDRHTRRFCFWCGVVHSDVEGHSRDLKCPKCSAGFANLREMEQHAVTT CSKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (Mucin 2) (rMLP/842), CF647 conjugate, 0.1mg/mL
BNC473609-100 1x 100 µL

MUC2 (Mucin 2) (rMLP/842), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CTRP3 (C1QTNF3) activation kit by CRISPRa
GA114488 1 Kit

Human CTRP3 (C1QTNF3) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS803874 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF640R conjugate, 0.1mg/mL
BNC402416-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lappaconitine Hydrobromide
TRC-L175855-500MG 500 mg

Lappaconitine Hydrobromide

Sign In for Pricing
View Details
Saitohin (STH) Mouse Monoclonal Antibody [Clone ID: OTI7A12]
CF810382 100 µg

Saitohin (STH) Mouse Monoclonal Antibody [Clone ID: OTI7A12]

Sign In for Pricing
View Details