Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Turkey astrovirus 1 Non-structural polyprotein 1A (ORF1)

This Recombinant Turkey astrovirus 1 Non-structural polyprotein 1A (ORF1) spans the amino acid sequence from region 796-1099.

Product Specifications

Product Name Alternative

Non-structural polyprotein 1A, Cleaved into the following 4 chains:, 1. Protein p19, 2. Transmembrane protein 1A, 3. Serine protease p27, 4. p27, EC= 5. 3.4.21.-, 6. Protein p20'

UniProt

Q9JH70

Expression Region

796-1099

Origin

Turkey astrovirus 1 (TAstV-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KKKGKTKRTARGGKHALGKKYLSKAHFSRMRMLTEEEYNKMVEDGFSPDEIKEVVDQLRE QAWQNYLIDNDIGEDDDLDWYDDMLEDERLNEEIDRRVEAALEDRGELAYQKIRRTFVDQ ALIHLITLKKGNWQTTKVECQPEREEAYKEQFQKAVKQEDLTEGTSYAIYSAGDATILIE NKEIDHTEIKPVTTGAKTVQEYPKDARTTVATFDDNKKDIVKTKRTTEIVLEQRKKTCRT CGETRPHNHKMCRDRHTRRFCFWCGVVHSDVEGHSRDLKCPKCSAGFANLREMEQHAVTT CSKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cefmetazole Lactone (~90%)
TRC-C242855-1MG 1 mg

Cefmetazole Lactone (~90%)

Sign In for Pricing
View Details
5-(1-(4-(Benzo[d]isothiazol-3-yl)piperazin-1-yl)-2-hydroxyethyl)-6-chloroindolin-2-one
TRC-B997110-5MG 5 mg

5-(1-(4-(Benzo[d]isothiazol-3-yl)piperazin-1-yl)-2-hydroxyethyl)-6-chloroindolin-2-one

Sign In for Pricing
View Details
MAK Mouse Monoclonal Antibody [Clone ID: OTI1G2]
CF808770 100 µg

MAK Mouse Monoclonal Antibody [Clone ID: OTI1G2]

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1718), CF568 conjugate, 0.1mg/mL
BNC682498-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1718), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Kallikrein 10 (KLK10) (NM_001077500) Human Over-expression Lysate
LY421448 100 µg

Kallikrein 10 (KLK10) (NM_001077500) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TP53TG5 activation kit by CRISPRa
GA109106 1 Kit

Human TP53TG5 activation kit by CRISPRa

Sign In for Pricing
View Details