Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus Dipeptide transport system permease protein dppC (dppC)

This Recombinant Bacillus pseudofirmus Dipeptide transport system permease protein dppC (dppC) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Dipeptide transport system permease protein dppC

UniProt

P94312

Expression Region

1-304

Origin

Bacillus pseudofirmus (strain OF4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTEHAKPLMTPEPNSPPPEDQYTAVSPWREAFKQLKKNKLAIVGLIIITSFILIAIFAP LLTSSSYAETNPSNRLQGPSAEHWFGTDDFGRDIFTRIVYGARLSLQVGFFAVTGALIFG TTLGLIAGYYGRWIDMLISRIFDIMLAFPSILLAIAIVAILGPSLQNALIAIAIVNVPIF GRLVRSKVISLREEEFIMAAKAQGMKNGRIIFHHILPNSLAPIIVQATLGFGTAILEAAA LGFLGLGAQAPMPEWGKMLSDSRQFIQSAPWTVLFPGFSIMLVVLGFNMIGDGLRDALDP KMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP9 Human Gene Knockout Kit (CRISPR)
KN202872BN 1 Kit

MMP9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-Rat CD71 (OX-26) In Vivo Antibody - Low Endotoxin
ICH1197-5mg 5 mg

Anti-Rat CD71 (OX-26) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
IL5RA (NM_175725) Human Recombinant Protein
TP305386 20 µg

IL5RA (NM_175725) Human Recombinant Protein

Sign In for Pricing
View Details
Glutathione Peroxidase 1 Polyclonal Antibody
E-AB-40584-01 25 µL

Glutathione Peroxidase 1 Polyclonal Antibody

Sign In for Pricing
View Details
Glutathione Peroxidase 1 Polyclonal Antibody
E-AB-40584-02 100 µL

Glutathione Peroxidase 1 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Adipose tissue
CB504972 1 Block

Frozen Tissue Blocks, Adipose tissue

Sign In for Pricing
View Details