Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Oligopeptide transport system permease protein oppC (oppC)

This Recombinant Bacillus subtilis Oligopeptide transport system permease protein oppC (oppC) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Oligopeptide transport system permease protein oppC, Stage 0 sporulation protein KC

UniProt

P24139

Expression Region

1-305

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNIPKNMFEPAAANAGDAEKISKKSLSLWKDAMLRFRSNKLAMVGLIIIVLIILMAIFA PMFSRYDYSTTNLLNADKPPSKDHWFGTDDLGRDIFVRTWVGARISIFIGVAAAVLDLLI GVIWGSISGFRGGRTDEIMMRIADILWAVPSLLMVILLMVVLPKGLFTIIIAMTITGWIN MARIVRGQVLQLKNQEYVLASQTLGAKTSRLLFKHIVPNAMGSILVTMTLTVPTAIFTEA FLSYLGLGVPAPLASWGTMASDGLPALTYYPWRLFFPAGFICITMFGFNVVGDGLRDALD PKLRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF568 conjugate, 0.1mg/mL
BNC680507-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006), CF405S conjugate, 0.1mg/mL
BNC040006-500 1x 500 µL

Bcl-x (BX006), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details