Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri serotype 5b Glutathione transport system permease protein gsiC (gsiC)

This Recombinant Shigella flexneri serotype 5b Glutathione transport system permease protein gsiC (gsiC) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Glutathione transport system permease protein gsiC

UniProt

Q0T6D1

Expression Region

1-306

Origin

Shigella flexneri serotype 5b (strain 8401)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQP LYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIA AVWRNRWPDRLSMTIAVSGISFPAFALGMFLIQVFSVELGWLPTVGADSWQHYILPSLTL GAAVAAVMARFTRASFVDVLSEDYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMGLQFG FLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVVDVLYAAIN PAIRYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP8 (NM_005154) Human Recombinant Protein
TP316926 20 µg

USP8 (NM_005154) Human Recombinant Protein

Sign In for Pricing
View Details
Chk2 (CHEK2) Rabbit Polyclonal Antibody
AP06051PU-N 100 µg

Chk2 (CHEK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sofalcone
TRC-S675500-1G 1 g

Sofalcone

Sign In for Pricing
View Details
MNS1 Mouse Monoclonal Antibody [Clone ID: OTI3D10]
CF810321 100 µg

MNS1 Mouse Monoclonal Antibody [Clone ID: OTI3D10]

Sign In for Pricing
View Details
CGK2 (PRKG2) (C-term) Rabbit Polyclonal Antibody
AP14907PU-N 400 µL

CGK2 (PRKG2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mix-n-StainTM CF®633 Antibody Labeling Kit, 1x (50-100ug) labeling
#92237 1 Kit

Mix-n-StainTM CF®633 Antibody Labeling Kit, 1x (50-100ug) labeling

Sign In for Pricing
View Details