Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial carnitine/acylcarnitine carrier protein CACL (Slc25a29)

This Recombinant Mouse Mitochondrial carnitine/acylcarnitine carrier protein CACL (Slc25a29) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Mitochondrial carnitine/acylcarnitine carrier protein CACL, CACT-like, Solute carrier family 25 member 29

UniProt

Q8BL03

Expression Region

1-306

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALDFLAGCAGGVAGVIVGHPFDIVKVRLQVQSTEKPQYRGTLHCFQSIIKQESVLGLYK GLGSPLMGLTFINALVFGVQGNTLRALGQDSPLNQFLAGAAAGAIQCVICCPMELAKTRL QLQAVGPARTYKGSLDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVMTRAMG CEPGDRLLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSYQ AEGWQVFTRGLASTLLRAFPVNAATFATVTVVLTYTRGEEAQVDSEAALGTSPTPAGSAL AQPSSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-100 1x 100 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
BNC740525-100 1x 100 µL

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e, Mouse (145-2C11), CF568 conjugate, 0.1mg/mL
BNC682013-500 1x 500 µL

CD3e, Mouse (145-2C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details