Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Congested-like trachea protein (colt)

This Recombinant Drosophila melanogaster Congested-like trachea protein (colt) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Congested-like trachea protein

UniProt

Q9VQG4

Expression Region

1-306

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTENVSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGT FDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFV AGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCA TMLRDLPANGLYFLVYEALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKS RLQSAPEGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANKFFN IVAPNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dulcitol Diepoxide
TRC-D720515-100MG 100 mg

Dulcitol Diepoxide

Sign In for Pricing
View Details
HDDC3 (NM_198527) Human Recombinant Protein
TP307636M 100 µg

HDDC3 (NM_198527) Human Recombinant Protein

Sign In for Pricing
View Details
Erdafitinib-D6 Hydrochloride
TRC-E888752-25MG 25 mg

Erdafitinib-D6 Hydrochloride

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2688), 1mg/mL
BNUM2688-50 1x 50 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2688), 1mg/mL

Sign In for Pricing
View Details
Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), 0.2mg/mL
BNUB1665-100 1x 100 µL

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), 0.2mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR559580 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details