Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Congested-like trachea protein (colt)

This Recombinant Drosophila melanogaster Congested-like trachea protein (colt) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Congested-like trachea protein

UniProt

Q9VQG4

Expression Region

1-306

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTENVSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGT FDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFV AGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCA TMLRDLPANGLYFLVYEALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKS RLQSAPEGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANKFFN IVAPNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gradient Thermal Cycler BTHC-603
BTHC-603 1 Unit

Gradient Thermal Cycler BTHC-603

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF568 conjugate, 0.1mg/mL
BNC680507-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKT1 Antibody
KC-4368-01 50 μL

AKT1 Antibody

Sign In for Pricing
View Details
AKT1 Antibody
KC-4368-02 100 µL

AKT1 Antibody

Sign In for Pricing
View Details
AKT1 Antibody
KC-4368-03 1 mL

AKT1 Antibody

Sign In for Pricing
View Details
GPR48 (LGR4) Human Gene Knockout Kit (CRISPR)
KN421345 1 Kit

GPR48 (LGR4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details