Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial brown fat uncoupling protein 1 (Ucp1)

This Recombinant Mouse Mitochondrial brown fat uncoupling protein 1 (Ucp1) spans the amino acid sequence from region 2-307.

Product Specifications

Product Name Alternative

Mitochondrial brown fat uncoupling protein 1, UCP 1, Solute carrier family 25 member 7, Thermogenin

UniProt

P12242

Expression Region

2-307

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VNPTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGT ITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKISAGL MTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNL MRNVIINCTELVTYDLMKGALVNNKILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFI NSLPGQYPSVPSCAMSMYTKEGPTAFFKGFVASFLRLGSWNVIMFVCFEQLKKELMKSRQ TVDCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE anti-mouse CD98
E16FMP098-050U 50 µg

PE anti-mouse CD98

Sign In for Pricing
View Details
LMO1 (NM_002315) Human Over-expression Lysate
LS004004 100 µg

LMO1 (NM_002315) Human Over-expression Lysate

Sign In for Pricing
View Details
CD6, Cynomolgus (HEK293, His)
HY-P703731 1 Each

CD6, Cynomolgus (HEK293, His)

Sign In for Pricing
View Details
Psd4 3'UTR Lenti-reporter-Luc Vector
37901086 1.0 µg

Psd4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human osteoclast differentiation factor, ODF ELISA KIT
E0158Hu-01 48 Well

Human osteoclast differentiation factor, ODF ELISA KIT

Sign In for Pricing
View Details
Human osteoclast differentiation factor, ODF ELISA KIT
E0158Hu-02 96 Well

Human osteoclast differentiation factor, ODF ELISA KIT

Sign In for Pricing
View Details