Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial brown fat uncoupling protein 1 (Ucp1)

This Recombinant Mouse Mitochondrial brown fat uncoupling protein 1 (Ucp1) spans the amino acid sequence from region 2-307.

Product Specifications

Product Name Alternative

Mitochondrial brown fat uncoupling protein 1, UCP 1, Solute carrier family 25 member 7, Thermogenin

UniProt

P12242

Expression Region

2-307

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VNPTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGT ITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKISAGL MTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNL MRNVIINCTELVTYDLMKGALVNNKILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFI NSLPGQYPSVPSCAMSMYTKEGPTAFFKGFVASFLRLGSWNVIMFVCFEQLKKELMKSRQ TVDCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARG1 Knockout 769-P Polyclonal Cells
ARG35092 1 Million

ARG1 Knockout 769-P Polyclonal Cells

Sign In for Pricing
View Details
TP53TG3 Human siRNA Oligo Duplex (Locus ID 24150)
SR308485 1 Kit

TP53TG3 Human siRNA Oligo Duplex (Locus ID 24150)

Sign In for Pricing
View Details
KDM4E AAV Vector (Human) (CMV)
25478101 1 µg

KDM4E AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
BCRL2 sgRNA CRISPR Lentivector (Human) (Target 2)
K0177903 1.0 µg DNA

BCRL2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
SRPX Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV689642 1.0 µg DNA

SRPX Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus D-ribose pyranase (rbsD)
MBS1256053-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus D-ribose pyranase (rbsD)

Sign In for Pricing
View Details