Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial brown fat uncoupling protein 1 (Ucp1)

This Recombinant Mouse Mitochondrial brown fat uncoupling protein 1 (Ucp1) spans the amino acid sequence from region 2-307.

Product Specifications

Product Name Alternative

Mitochondrial brown fat uncoupling protein 1, UCP 1, Solute carrier family 25 member 7, Thermogenin

UniProt

P12242

Expression Region

2-307

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VNPTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGT ITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKISAGL MTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNL MRNVIINCTELVTYDLMKGALVNNKILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFI NSLPGQYPSVPSCAMSMYTKEGPTAFFKGFVASFLRLGSWNVIMFVCFEQLKKELMKSRQ TVDCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,4’-Azodianiline
TRC-A940000-100MG 100 mg

4,4’-Azodianiline

Sign In for Pricing
View Details
Angular rotor
E2733 1 Unit

Angular rotor

Sign In for Pricing
View Details
CCL25 Antibody
orb2809105 100 µL

CCL25 Antibody

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Toll Like Receptor 6 (TLR6)
MBS2045961-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Toll Like Receptor 6 (TLR6)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Toll Like Receptor 6 (TLR6)
MBS2045961-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Toll Like Receptor 6 (TLR6)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Toll Like Receptor 6 (TLR6)
MBS2045961-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Toll Like Receptor 6 (TLR6)

Sign In for Pricing
View Details