Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Mitochondrial brown fat uncoupling protein 1 (UCP1)

This Recombinant Rabbit Mitochondrial brown fat uncoupling protein 1 (UCP1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Mitochondrial brown fat uncoupling protein 1, UCP 1, Solute carrier family 25 member 7, Thermogenin

UniProt

P14271

Expression Region

1-306

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGTTTTDVPPTMGVKIFSAGVAACLADVITFPLDTAKVRQQIQGEFPITSGIRYKGVLG TITTLAKTEGPLKLYSGLPAGLQRQISFASLRIGLYDTVQEFFTSGEETPSLGSKISAGL TTGGVAVFIGQPTEVVKVRLQAQSHLHGLKPRYTGTYNAYRIIATTESLTSLWKGTTPNL LRNVIINCTELVTYDLMKGALVRNEILADDVPCHFVSALIAGFCTTLLSSPVDVVKTRFI NSPPGQYASVPNCAMTMFTKEGPTAFFKGFVPSFLRLGSWNVIMFVCFEKLKGELMRSRQ TVDCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enniatin complex
T11202-01 10 mg

Enniatin complex

Sign In for Pricing
View Details
Enniatin complex
T11202-02 50 mg

Enniatin complex

Sign In for Pricing
View Details
ZXDC Protein Vector (Mouse) (pPB-N-His)
PV251203 500 ng

ZXDC Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
MAP3K10 Protein Vector (Rat) (pPM-C-HA)
PV280968 500 ng

MAP3K10 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
BAZ2A Antibody
OACA09710-100UG 100 µg

BAZ2A Antibody

Sign In for Pricing
View Details
Armenian Hamster Monoclonal IL-1 RI Antibody (JAMA-147) [CoraFluor 1]
NB100-65865CL1 0.1 mL

Armenian Hamster Monoclonal IL-1 RI Antibody (JAMA-147) [CoraFluor 1]

Sign In for Pricing
View Details