Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Mitochondrial brown fat uncoupling protein 1 (UCP1)

This Recombinant Rabbit Mitochondrial brown fat uncoupling protein 1 (UCP1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Mitochondrial brown fat uncoupling protein 1, UCP 1, Solute carrier family 25 member 7, Thermogenin

UniProt

P14271

Expression Region

1-306

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGTTTTDVPPTMGVKIFSAGVAACLADVITFPLDTAKVRQQIQGEFPITSGIRYKGVLG TITTLAKTEGPLKLYSGLPAGLQRQISFASLRIGLYDTVQEFFTSGEETPSLGSKISAGL TTGGVAVFIGQPTEVVKVRLQAQSHLHGLKPRYTGTYNAYRIIATTESLTSLWKGTTPNL LRNVIINCTELVTYDLMKGALVRNEILADDVPCHFVSALIAGFCTTLLSSPVDVVKTRFI NSPPGQYASVPNCAMTMFTKEGPTAFFKGFVPSFLRLGSWNVIMFVCFEKLKGELMRSRQ TVDCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OOCA00855-25T - Human HSPA8 Primer Pair 1
OOCA00855-25T 25 Tests

OOCA00855-25T - Human HSPA8 Primer Pair 1

Sign In for Pricing
View Details
Rabbit Polyclonal IQSEC1 Antibody [mFluor Violet 450 SE]
NBP2-81958MFV450 0.1 mL

Rabbit Polyclonal IQSEC1 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Uncharacterized protein Rv0476/MT0494.1 (Rv0476, MT0494.1), partial
MBS7061930 Inquire

Recombinant Mycobacterium tuberculosis Uncharacterized protein Rv0476/MT0494.1 (Rv0476, MT0494.1), partial

Sign In for Pricing
View Details
Bcl-xS/L siRNA (h)
sc-29216 10 µM

Bcl-xS/L siRNA (h)

Sign In for Pricing
View Details
Recombinant Aeromonas hydrophila subsp. hydrophila Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1073771-01 0.02 mg (E-Coli)

Recombinant Aeromonas hydrophila subsp. hydrophila Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details
Recombinant Aeromonas hydrophila subsp. hydrophila Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1073771-02 0.1 mg (E-Coli)

Recombinant Aeromonas hydrophila subsp. hydrophila Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details