Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Potassium-transporting ATPase A chain 2 (kdpA2)

This Recombinant Potassium-transporting ATPase A chain 2 (kdpA2) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase A chain 2, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] A chain 2, Potassium-binding and translocating subunit A 2, Potassium-translocating ATPase A cha

UniProt

P0A058

Expression Region

1-307

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ALSMMLIPGSLVFLFGRMLKTKLQIHPHAIMIFVAMFVMFIGFLVTCLYFEFAGNPVLHH LGIAGGNMEGKETRFGIGLSALFTTITTAFTTGTVNNMHDSLTPLGGMVPMVLMMLNAVF GGEGVGLMNMLIYVMLTVFICSLMIGKTPSYLGMKIEGKEMKLIALSFLVHPLLILVFSA LAFIVPGASDALTNPQFHGVSQVLYEFTSSSANNGSGFEGLGDNTVFWNISTGIVMLLAR YIPIVLQILIVSSLVNKKTYQQHTQDVPINNLFFSSVLIIFIILLSGLTFLPDLMLGPIG EQLLLHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-[1-(Benzyloxy)-2-oxo-3-azetidinyl]carbamic Acid Benzyl Ester
TRC-B287500-50MG 50 mg

(S)-[1-(Benzyloxy)-2-oxo-3-azetidinyl]carbamic Acid Benzyl Ester

Sign In for Pricing
View Details
RING1 Human Knockdown Lysate
LY300289 100 µg

RING1 Human Knockdown Lysate

Sign In for Pricing
View Details
P38 alpha/MAPK14 + p38 beta/MAPK11 + p38 gamma/MAPK12 Recombinant Rabbit monoclonal Antibody
HA750894 100 µL

P38 alpha/MAPK14 + p38 beta/MAPK11 + p38 gamma/MAPK12 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
GSDME Rabbit Monoclonal Antibody [Clone ID: R09-7C1]
TA384338 100 µL

GSDME Rabbit Monoclonal Antibody [Clone ID: R09-7C1]

Sign In for Pricing
View Details
POU3F2 (NM_005604) Human Recombinant Protein
TP305330M 100 µg

POU3F2 (NM_005604) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant HMGCR Monoclonal Antibody
AN301555L-01 50 µL

Recombinant HMGCR Monoclonal Antibody

Sign In for Pricing
View Details