Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Potassium-transporting ATPase A chain 2 (kdpA2)

This Recombinant Potassium-transporting ATPase A chain 2 (kdpA2) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase A chain 2, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] A chain 2, Potassium-binding and translocating subunit A 2, Potassium-translocating ATPase A cha

UniProt

P0A058

Expression Region

1-307

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ALSMMLIPGSLVFLFGRMLKTKLQIHPHAIMIFVAMFVMFIGFLVTCLYFEFAGNPVLHH LGIAGGNMEGKETRFGIGLSALFTTITTAFTTGTVNNMHDSLTPLGGMVPMVLMMLNAVF GGEGVGLMNMLIYVMLTVFICSLMIGKTPSYLGMKIEGKEMKLIALSFLVHPLLILVFSA LAFIVPGASDALTNPQFHGVSQVLYEFTSSSANNGSGFEGLGDNTVFWNISTGIVMLLAR YIPIVLQILIVSSLVNKKTYQQHTQDVPINNLFFSSVLIIFIILLSGLTFLPDLMLGPIG EQLLLHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Esophagus
CS715369 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
MBNL1 (NM_207293) Human Over-expression Lysate
LC404076 20 µg

MBNL1 (NM_207293) Human Over-expression Lysate

Sign In for Pricing
View Details
ALDOA Goat Polyclonal Antibody
TA396710S 25 µL

ALDOA Goat Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse CD11b (M1/70) In Vivo Antibody - Low Endotoxin
ICH1049-25mg 25 mg

Anti-Mouse CD11b (M1/70) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
TrnI Rabbit Polyclonal Antibody
TA378766 100 µL

TrnI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IP3KC (ITPKC) Rabbit Polyclonal Antibody
TA368560 100 µL

IP3KC (ITPKC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details