Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial carrier triple repeat protein 6 (MCART6)

This Recombinant Human Mitochondrial carrier triple repeat protein 6 (MCART6) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Mitochondrial carrier triple repeat protein 6

UniProt

Q5H9E4

Expression Region

1-307

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEQNHSPGKELQHRTRAEAPGKKSWHSQAYALGAVSNFMSTFLTFPIYKVVFRQQIHAM AVSEAVRQLWHEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSLLCFLSPVGPHTLGHRWAA GLMSGVVEAVALSPFERVQNVLQDGRKQARFPSTFSILKEFNSYGLWGRLSLGYYRGFWP VLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLVLYPLIVLVANMQ SHIGWQNMPSLWASAQDVWNTRGRKLLLIYRGGSLVILRSSVTWGLTTAIHDFLQRKSHS RKELKTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(±)-Menthyl Acetate
TRC-M218715-1ML 1 mL

(±)-Menthyl Acetate

Sign In for Pricing
View Details
beta 3 Adrenergic Receptor (ADRB3) Human Gene Knockout Kit (CRISPR)
KN210428RB 1 Kit

beta 3 Adrenergic Receptor (ADRB3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (CA72/2869R), CF640R conjugate, 0.1mg/mL
BNC402869-500 1x 500 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (CA72/2869R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hsp60 (HSPD1) (1-573) Mouse Monoclonal Antibody [Clone ID: 2E4]
AM03128PU-S 50 µL

Hsp60 (HSPD1) (1-573) Mouse Monoclonal Antibody [Clone ID: 2E4]

Sign In for Pricing
View Details
AMPD3 (NM_000480) Human Over-expression Lysate
LC424690 20 µg

AMPD3 (NM_000480) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Laminin Beta 3 (LAMb3) ELISA Kit
RD-LAMb3-Hu-01 96 Tests

Human Laminin Beta 3 (LAMb3) ELISA Kit

Sign In for Pricing
View Details