Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial carrier triple repeat protein 6 (MCART6)

This Recombinant Human Mitochondrial carrier triple repeat protein 6 (MCART6) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Mitochondrial carrier triple repeat protein 6

UniProt

Q5H9E4

Expression Region

1-307

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEQNHSPGKELQHRTRAEAPGKKSWHSQAYALGAVSNFMSTFLTFPIYKVVFRQQIHAM AVSEAVRQLWHEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSLLCFLSPVGPHTLGHRWAA GLMSGVVEAVALSPFERVQNVLQDGRKQARFPSTFSILKEFNSYGLWGRLSLGYYRGFWP VLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLVLYPLIVLVANMQ SHIGWQNMPSLWASAQDVWNTRGRKLLLIYRGGSLVILRSSVTWGLTTAIHDFLQRKSHS RKELKTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PON2 Antibody
RC-5114-01 50 μL

Recombinant PON2 Antibody

Sign In for Pricing
View Details
Recombinant PON2 Antibody
RC-5114-02 100 µL

Recombinant PON2 Antibody

Sign In for Pricing
View Details
Recombinant PON2 Antibody
RC-5114-03 1 mL

Recombinant PON2 Antibody

Sign In for Pricing
View Details
RWDD3 Mouse Monoclonal Antibody [Clone ID: OTI10H4]
CF811763 100 µg

RWDD3 Mouse Monoclonal Antibody [Clone ID: OTI10H4]

Sign In for Pricing
View Details
Diosmetin 3’,7-Diglucuronide (>85%)
TRC-D485040-1MG 1 mg

Diosmetin 3’,7-Diglucuronide (>85%)

Sign In for Pricing
View Details
(E)-3-Cyclopentylprop-2-enoic Acid
TRC-E326005-2.5G 2.5 g

(E)-3-Cyclopentylprop-2-enoic Acid

Sign In for Pricing
View Details