Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

This Recombinant Candida glabrata Mitochondrial thiamine pyrophosphate carrier 1 (TPC1) spans the amino acid sequence from region 1-307.

Product Specifications

Product Name Alternative

Mitochondrial thiamine pyrophosphate carrier 1

UniProt

Q6FTE5

Expression Region

1-307

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANVLINILK REGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMT SSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIM FGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPN EERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYE LFMNKLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-500 1x 500 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P34 / cdk1 (POH-1), CF568 conjugate, 0.1mg/mL
BNC680853-500 1x 500 µL

P34 / cdk1 (POH-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF568 conjugate, 0.1mg/mL
BNC681927-100 1x 100 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF594 conjugate, 0.1mg/mL
BNC942040-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details