Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oligopeptide transport system permease protein AmiD (amiD)

This Recombinant Oligopeptide transport system permease protein AmiD (amiD) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Oligopeptide transport system permease protein AmiD

UniProt

P0A4M9

Expression Region

1-308

Origin

Streptococcus pneumoniae

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIDKEKFQFVKRDDFASETIDAPAYSYWKSVFKQFMKKKSTVVMLGILVAIILISFIY PMFSKFDFNDVSKVNDFSVRYIKPNAEHWFGTDSNGKSLFDGVWFGARNSILISVIATVI NLVIGVFVGGIWGISKSVDRVMMEVYNVISNIPPLLIVIVLTYSIGAGFWNLIFAMSVTT WIGIAFMIRVQILRYRDLEYNLASRTLGTPTLKIVAKNIMPQLVSVIVTTMTQMLPSFIS YEAFLSFFGLGLPITVPSLGRLISDYSQNVTTNAYLFWIPLTTLVLVSLSLFVVGQNLAD ASDPRTHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRG1 Protein, Human, Recombinant
PH51485M0 50 µg

LRG1 Protein, Human, Recombinant

Sign In for Pricing
View Details
SAP30BP Rabbit Polyclonal Antibody
TA335645 100 µL

SAP30BP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human ADGRE5 sgRNA gene knockout kit - Lentiviral human ADGRE5 sgRNA gene knockout kit (plasmid)
GTR15354211 1 Vial

Lentiviral human ADGRE5 sgRNA gene knockout kit - Lentiviral human ADGRE5 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
SOCS3 Rabbit Polyclonal Antibody (Cy3)
orb1599999 100 µL

SOCS3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Lhfpl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6381007 1.0 µg DNA

Lhfpl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
AFAP1L2 Human Pre-designed siRNA Set A
HY-RS00426 1 Set

AFAP1L2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details