Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia rickettsii Protein translocase subunit SecF (secF)

This Recombinant Rickettsia rickettsii Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

A8GQT5

Expression Region

1-308

Origin

Rickettsia rickettsii (strain Sheila Smith)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQIYPLRLLPNKIDFDFMNFKKVSYTFSIILSLISFIWIGIYKFNFGIDFAGGIVIEVRL DQAPDLPKMRGVLGKLGIGEVVLQNFGSERDLSIRFGSNSEENLMKNIELIKGSLQSNFP YKFEYRKVDFVGPQVGRQLIEAGAMAMLFSFLAIMVYIWVRFEWYFGFGILIALVHDVIL ALGFMSMTKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKNITEIINLSINE TLSRTILTVITTLLANLALILFGGEAIRSFSILVFFGIIVGTYSSIFISAPILTMFVNRK FNKKVIER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF594 conjugate, 0.1mg/mL
BNC942968-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ERO1LB (ERO1B) Human Gene Knockout Kit (CRISPR)
KN208445LP 1 Kit

ERO1LB (ERO1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lung Specific Antigen (LSA120), Biotin conjugate, 0.1mg/mL
BNCB0120-100 1x 100 µL

Lung Specific Antigen (LSA120), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TSEN2 (NM_001145392) Human Recombinant Protein
TP326917L 1 mg

TSEN2 (NM_001145392) Human Recombinant Protein

Sign In for Pricing
View Details
Human MMRN1 activation kit by CRISPRa
GA107908 1 Kit

Human MMRN1 activation kit by CRISPRa

Sign In for Pricing
View Details
OA1 (GPR143) Rabbit Polyclonal Antibody
TA376726 100 µL

OA1 (GPR143) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details