Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alicyclobacillus acidocaldarius subsp. acidocaldarius Protein translocase subunit SecF (secF)

This Recombinant Alicyclobacillus acidocaldarius subsp. acidocaldarius Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

C8WQG6

Expression Region

1-308

Origin

Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / 104-1A) (Bacillus acidocaldarius)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKPRFDIIRASRWFFLLSGAITVAGVIVFALFGFNLSTDFKSGSEVQFELNQRVPEARVR QMFASIGLPLGDTSLTVGGIQQNVVMVTLPEQLTAKQISEIQAAEHRFFPDAKQDIQVNS VDPFVAEQTARKAVYAVLAAAACIVVYIAIRFEFRFAISGIIALLHDAFIVLAAFALLRR EVDLTFVAALLTIVGYSINDTIVIFDRIRENLKIDKPETVDELRAVVNKSLWQVMNRSIR TVLTVLIAAVILYFFGGISIRNFTFALIIGLVSGAYSSIFIASPIWVAWRSRSMKKATRG DKAAPIPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-500 1x 500 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-500 1x 500 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (MYD712), CF568 conjugate, 0.1mg/mL
BNC680712-500 1x 500 µL

MyoD1 (MYD712), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF647 conjugate, 0.1mg/mL
BNC472054-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details