Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Suncus murinus Mitochondrial brown fat uncoupling protein 1 (UCP1)

This Recombinant Suncus murinus Mitochondrial brown fat uncoupling protein 1 (UCP1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitochondrial brown fat uncoupling protein 1, UCP 1, Solute carrier family 25 member 7, Thermogenin

UniProt

Q18P97

Expression Region

1-308

Origin

Suncus murinus (Asian house shrew) (Musk shrew)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASAEADVPPPTMLVKIASAGLSACLADIITFPLDTAKVRLQVQGERPNAPGVKYKGVL GTIATVAKTEGPLKLYGGLPAGIQRQISFASLRIGLYDTVQEYFNAHRKTPATLGNKISA GLMTGCVTVFIGQPTEVAKVRMQAQSSLHWLKPRYSGTYNAYYVIVKTEGFLGLWKGTSL NLTRNVIINCTELVVYDVLKEALVKNNVLADDIPCHLLAALTAGFCTTALASPVDVVKTR FINSPPGYYPHVHNCALNMLQKEGLRAFFKGFVPSFLRLGSWTVIMHVTFEQLKKELMKS RQTVDCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLXDC1 3'UTR GFP Stable Cell Line
TU068300 1.0 mL

PLXDC1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Defa26 (NM_001079933) Mouse Tagged ORF Clone
MG220255 10 µg

Defa26 (NM_001079933) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rat Monoclonal Antibody to phospho-NLRC4 (Ser-533)
MBS8528414-01 0.1 mL

Rat Monoclonal Antibody to phospho-NLRC4 (Ser-533)

Sign In for Pricing
View Details
Rat Monoclonal Antibody to phospho-NLRC4 (Ser-533)
MBS8528414-02 0.1 mL (AF405L)

Rat Monoclonal Antibody to phospho-NLRC4 (Ser-533)

Sign In for Pricing
View Details
Rat Monoclonal Antibody to phospho-NLRC4 (Ser-533)
MBS8528414-03 0.1 mL (AF405S)

Rat Monoclonal Antibody to phospho-NLRC4 (Ser-533)

Sign In for Pricing
View Details
Rat Monoclonal Antibody to phospho-NLRC4 (Ser-533)
MBS8528414-04 0.1 mL (AF610)

Rat Monoclonal Antibody to phospho-NLRC4 (Ser-533)

Sign In for Pricing
View Details