Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Suncus murinus Mitochondrial brown fat uncoupling protein 1 (UCP1)

This Recombinant Suncus murinus Mitochondrial brown fat uncoupling protein 1 (UCP1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitochondrial brown fat uncoupling protein 1, UCP 1, Solute carrier family 25 member 7, Thermogenin

UniProt

Q18P97

Expression Region

1-308

Origin

Suncus murinus (Asian house shrew) (Musk shrew)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASAEADVPPPTMLVKIASAGLSACLADIITFPLDTAKVRLQVQGERPNAPGVKYKGVL GTIATVAKTEGPLKLYGGLPAGIQRQISFASLRIGLYDTVQEYFNAHRKTPATLGNKISA GLMTGCVTVFIGQPTEVAKVRMQAQSSLHWLKPRYSGTYNAYYVIVKTEGFLGLWKGTSL NLTRNVIINCTELVVYDVLKEALVKNNVLADDIPCHLLAALTAGFCTTALASPVDVVKTR FINSPPGYYPHVHNCALNMLQKEGLRAFFKGFVPSFLRLGSWTVIMHVTFEQLKKELMKS RQTVDCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ugt2b5-set siRNA/shRNA/RNAi Lentivector (Mouse)
49145094 4x 500 ng

Ugt2b5-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Hecw1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3492408 1.0 µg DNA

Hecw1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
POM121L7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1686607 1.0 µg DNA

POM121L7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
RGS16 antibody
10R-5613 100 µL

RGS16 antibody

Sign In for Pricing
View Details
Human Protein Kinase R (PKR) ELISA Kit
RD-PKR-Hu-48Tests 48 Tests

Human Protein Kinase R (PKR) ELISA Kit

Sign In for Pricing
View Details
PLBD2 ORF Vector (Human) (pORF)
36937011 1.0 µg DNA

PLBD2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details