Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Suncus murinus Mitochondrial brown fat uncoupling protein 1 (UCP1)

This Recombinant Suncus murinus Mitochondrial brown fat uncoupling protein 1 (UCP1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitochondrial brown fat uncoupling protein 1, UCP 1, Solute carrier family 25 member 7, Thermogenin

UniProt

Q18P97

Expression Region

1-308

Origin

Suncus murinus (Asian house shrew) (Musk shrew)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASAEADVPPPTMLVKIASAGLSACLADIITFPLDTAKVRLQVQGERPNAPGVKYKGVL GTIATVAKTEGPLKLYGGLPAGIQRQISFASLRIGLYDTVQEYFNAHRKTPATLGNKISA GLMTGCVTVFIGQPTEVAKVRMQAQSSLHWLKPRYSGTYNAYYVIVKTEGFLGLWKGTSL NLTRNVIINCTELVVYDVLKEALVKNNVLADDIPCHLLAALTAGFCTTALASPVDVVKTR FINSPPGYYPHVHNCALNMLQKEGLRAFFKGFVPSFLRLGSWTVIMHVTFEQLKKELMKS RQTVDCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIE, NT (Tyrosine-protein Kinase Receptor Tie-1, TIE1) (MaxLight 650) discontinued
T5498-65A-ML650 100 µL

TIE, NT (Tyrosine-protein Kinase Receptor Tie-1, TIE1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Anti-CLDN6 Antibody (AB3-7)
F1676-.1 100 µg

Anti-CLDN6 Antibody (AB3-7)

Sign In for Pricing
View Details
Junctional Adhesion Molecule 1 (JAM 1, JAM-1, JAM1, CD321, F11 Receptor, F11R, Junctional Adhesion Molecule A, JAMA, JCAM, KAT, Platelet Adhesion Molecule 1, PAM1, Platelet F11 Receptor, UNQ264/PRO301) (HRP) discontinued
J8009-04E-HRP 100 µL

Junctional Adhesion Molecule 1 (JAM 1, JAM-1, JAM1, CD321, F11 Receptor, F11R, Junctional Adhesion Molecule A, JAMA, JCAM, KAT, Platelet Adhesion Molecule 1, PAM1, Platelet F11 Receptor, UNQ264/PRO301) (HRP) discontinued

Sign In for Pricing
View Details
PIK-293
MBS8506157-01 5 mg

PIK-293

Sign In for Pricing
View Details
PIK-293
MBS8506157-02 5x 5 mg

PIK-293

Sign In for Pricing
View Details
Recombinant Greasyback shrimp Met e 1/Tropomyosin Protein, N-His
MBS1577808-01 0.1 mg

Recombinant Greasyback shrimp Met e 1/Tropomyosin Protein, N-His

Sign In for Pricing
View Details