Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Suncus murinus Mitochondrial brown fat uncoupling protein 1 (UCP1)

This Recombinant Suncus murinus Mitochondrial brown fat uncoupling protein 1 (UCP1) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitochondrial brown fat uncoupling protein 1, UCP 1, Solute carrier family 25 member 7, Thermogenin

UniProt

Q18P97

Expression Region

1-308

Origin

Suncus murinus (Asian house shrew) (Musk shrew)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASAEADVPPPTMLVKIASAGLSACLADIITFPLDTAKVRLQVQGERPNAPGVKYKGVL GTIATVAKTEGPLKLYGGLPAGIQRQISFASLRIGLYDTVQEYFNAHRKTPATLGNKISA GLMTGCVTVFIGQPTEVAKVRMQAQSSLHWLKPRYSGTYNAYYVIVKTEGFLGLWKGTSL NLTRNVIINCTELVVYDVLKEALVKNNVLADDIPCHLLAALTAGFCTTALASPVDVVKTR FINSPPGYYPHVHNCALNMLQKEGLRAFFKGFVPSFLRLGSWTVIMHVTFEQLKKELMKS RQTVDCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BYSL Protein Lysate
OCOA01193-20UG 20 µg

BYSL Protein Lysate

Sign In for Pricing
View Details
Anti-Human ASIC1 Nanobody (SAA1106)
HX873013-01 50 µg

Anti-Human ASIC1 Nanobody (SAA1106)

Sign In for Pricing
View Details
Anti-Human ASIC1 Nanobody (SAA1106)
HX873013-02 100 µg

Anti-Human ASIC1 Nanobody (SAA1106)

Sign In for Pricing
View Details
Anti-Human ASIC1 Nanobody (SAA1106)
HX873013-03 1 mg

Anti-Human ASIC1 Nanobody (SAA1106)

Sign In for Pricing
View Details
CCDC59 (NM_014167) Human Over-expression Lysate
LS029080-20ug 20 µg

CCDC59 (NM_014167) Human Over-expression Lysate

Sign In for Pricing
View Details
Human basic fibroblast growth factor 6,bFGF-6 ELISA KIT
JOT-EK0119Hu-01 96 Well

Human basic fibroblast growth factor 6,bFGF-6 ELISA KIT

Sign In for Pricing
View Details