Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides sp. Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Dehalococcoides sp. Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

Q3ZX56

Expression Region

1-308

Origin

Dehalococcoides sp. (strain CBDB1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEILLIFLLALVIDMVFGDPPNAFHPVAYMGKVISLFERAGFKGGKGYQFVYGIVMVIFT MALFFVPVYFLLDWLQGINSIVYIIVSAILFKMCFTVTGLRKAALLIKRLLEKDDIAQAR FELRSLVSRDTSKLPQPKLVAAAVESVAESIGDGFVAPLFFFLIFGVPGVMAYRVVSTFD SMVGYRGKYEYLGKFAARFDDVLNFIPARLSALCILVASFFGRYSPAGAWRIMWRDHGKT QSPNAGWPMATAAGALEVCLEKVGHYSLGDDIRPLLPQTISCSLVLINNAGCIWVLISVG VIYFARIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HFH4 (FOXJ1) (NM_001454) Human Over-expression Lysate
LC419928 20 µg

HFH4 (FOXJ1) (NM_001454) Human Over-expression Lysate

Sign In for Pricing
View Details
CLEC18B Human Gene Knockout Kit (CRISPR)
KN415966 1 Kit

CLEC18B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3540), CF640R conjugate, 0.1mg/mL
BNC403540-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3540), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lair1 Mouse Gene Knockout Kit (CRISPR)
KN309105 1 Kit

Lair1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit
E-EL-H6210-01 24 Tests

Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit

Sign In for Pricing
View Details
Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit
E-EL-H6210-02 48 Tests

Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit

Sign In for Pricing
View Details