Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Mitoferrin (mcfF)

This Recombinant Dictyostelium discoideum Mitoferrin (mcfF) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitoferrin, Mitochondrial substrate carrier family protein F

UniProt

Q55DY8

Expression Region

1-308

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGDHGHSHGDEGGSFYVHLIAGAAAGFAEHCGMYPIDTIKTHIQAIKPGAMQTSSLQIT KHIIQQHGITGLFRGLTAVAAGAAPSHAVHFSIYELLKFKFIGSDEDHHPIKVGIAGAIA TMTSEAVASPMDVVKQRLQLQITDYKGLTDCTKRIWVKEGIRGFYSGYTTTLVMNVPYNI VYFASYESLKKIIQPWFNNKNPEERSYQLIDHLVAGGGAGMLAAAFTNPFDVVKTRLQTQ SDFIASSTINSAKSIKRYGGMMDAMKTIWIEEGMDGYLRGMKPRMVFHSMSSAIVWSVYE YFKFILGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DM1 Mouse Monoclonal Antibody [A4G3]
HA600014 100 µL

DM1 Mouse Monoclonal Antibody [A4G3]

Sign In for Pricing
View Details
4,4'-Oxybis[p-(phenylsulfonylaniline)] Hydrochloride
TRC-O870561-10MG 10 mg

4,4'-Oxybis[p-(phenylsulfonylaniline)] Hydrochloride

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + OV-TL12/30), CF594 conjugate, 0.1mg/mL
BNC941167-100 1x 100 µL

Cytokeratin 7 (KRT7/760 + OV-TL12/30), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RNF36 (TRIM69) (Center) Rabbit Polyclonal Antibody
AP12251PU-N 400 µL

RNF36 (TRIM69) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Parathyroid hormone related protein (PTHLH) (NM_198966) Human Over-expression Lysate
LY430780 100 µg

Parathyroid hormone related protein (PTHLH) (NM_198966) Human Over-expression Lysate

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), CF488A conjugate, 0.1mg/mL
BNC880898-100 1x 100 µL

GFAP (GA-5 + ASTRO/789), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details