Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Mitoferrin (mcfF)

This Recombinant Dictyostelium discoideum Mitoferrin (mcfF) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitoferrin, Mitochondrial substrate carrier family protein F

UniProt

Q55DY8

Expression Region

1-308

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGDHGHSHGDEGGSFYVHLIAGAAAGFAEHCGMYPIDTIKTHIQAIKPGAMQTSSLQIT KHIIQQHGITGLFRGLTAVAAGAAPSHAVHFSIYELLKFKFIGSDEDHHPIKVGIAGAIA TMTSEAVASPMDVVKQRLQLQITDYKGLTDCTKRIWVKEGIRGFYSGYTTTLVMNVPYNI VYFASYESLKKIIQPWFNNKNPEERSYQLIDHLVAGGGAGMLAAAFTNPFDVVKTRLQTQ SDFIASSTINSAKSIKRYGGMMDAMKTIWIEEGMDGYLRGMKPRMVFHSMSSAIVWSVYE YFKFILGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IGFBP-4 Protein (His Tag)
PDMH100290-01 20 µg

Recombinant Human IGFBP-4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IGFBP-4 Protein (His Tag)
PDMH100290-02 100 µg

Recombinant Human IGFBP-4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IGFBP-4 Protein (His Tag)
PDMH100290-03 500 µg

Recombinant Human IGFBP-4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IGFBP-4 Protein (His Tag)
PDMH100290-04 1 mg

Recombinant Human IGFBP-4 Protein (His Tag)

Sign In for Pricing
View Details
AKT1 Recombinant Rabbit monoclonal Antibody
HA750627 100 µL

AKT1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SIRT2 Recombinant Chimeric Antibody Antibody
HA601505 100 µL

SIRT2 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details