Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Mitoferrin (mcfF)

This Recombinant Dictyostelium discoideum Mitoferrin (mcfF) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitoferrin, Mitochondrial substrate carrier family protein F

UniProt

Q55DY8

Expression Region

1-308

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGDHGHSHGDEGGSFYVHLIAGAAAGFAEHCGMYPIDTIKTHIQAIKPGAMQTSSLQIT KHIIQQHGITGLFRGLTAVAAGAAPSHAVHFSIYELLKFKFIGSDEDHHPIKVGIAGAIA TMTSEAVASPMDVVKQRLQLQITDYKGLTDCTKRIWVKEGIRGFYSGYTTTLVMNVPYNI VYFASYESLKKIIQPWFNNKNPEERSYQLIDHLVAGGGAGMLAAAFTNPFDVVKTRLQTQ SDFIASSTINSAKSIKRYGGMMDAMKTIWIEEGMDGYLRGMKPRMVFHSMSSAIVWSVYE YFKFILGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem151b Mouse Gene Knockout Kit (CRISPR)
KN517739 1 Kit

Tmem151b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cambendazole (>90%)
TRC-C149500-500MG 500 mg

Cambendazole (>90%)

Sign In for Pricing
View Details
Netobimin Sodium Salt
TRC-N390900-10MG 10 mg

Netobimin Sodium Salt

Sign In for Pricing
View Details
Human ACTα1 (Actin Alpha 1, Skeletal Muscle) CLIA Kit
E-CL-H0217-01 24 Tests

Human ACTα1 (Actin Alpha 1, Skeletal Muscle) CLIA Kit

Sign In for Pricing
View Details
Human ACTα1 (Actin Alpha 1, Skeletal Muscle) CLIA Kit
E-CL-H0217-02 48 Tests

Human ACTα1 (Actin Alpha 1, Skeletal Muscle) CLIA Kit

Sign In for Pricing
View Details
Human ACTα1 (Actin Alpha 1, Skeletal Muscle) CLIA Kit
E-CL-H0217-03 96 Tests

Human ACTα1 (Actin Alpha 1, Skeletal Muscle) CLIA Kit

Sign In for Pricing
View Details