Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi Protein translocase subunit SecF (secF)

This Recombinant Rickettsia typhi Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

Q68XY2

Expression Region

1-308

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQIYPLRFVPNKINFDFMNFKKVSYSFSIILSLISLIWIGIYKFNFGIDFVGGIVIEVRL DRAPDLPKMRAVLSALGIGEVVLQNFESEHDLSIRFGSSSEENLMKNIDIIKTSLRNNFP YNFEYRKVDFVGPQVGRHLIEAGAMAMLFSFLAIMVYIGVRFEWYFGFGILIALVHDVIL ALGFMSITKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKNITEIINLSINE TLSRTILTVITTLLANLALILFGGKAIHSFSVLVFFGIIAGTYSSIFISAPILTIFANRK FNKKVIER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOB.1 (B-Cell Marker) (BOB1/2421), CF405S conjugate, 0.1mg/mL
BNC042421-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2421), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GEMIN2 Polyclonal Antibody
E-AB-12645-01 20 µL

GEMIN2 Polyclonal Antibody

Sign In for Pricing
View Details
GEMIN2 Polyclonal Antibody
E-AB-12645-02 60 µL

GEMIN2 Polyclonal Antibody

Sign In for Pricing
View Details
GEMIN2 Polyclonal Antibody
E-AB-12645-03 120 µL

GEMIN2 Polyclonal Antibody

Sign In for Pricing
View Details
GEMIN2 Polyclonal Antibody
E-AB-12645-04 200 µL

GEMIN2 Polyclonal Antibody

Sign In for Pricing
View Details
Gemin 8 (GEMIN8) (NM_001042479) Human Over-expression Lysate
LC420932 20 µg

Gemin 8 (GEMIN8) (NM_001042479) Human Over-expression Lysate

Sign In for Pricing
View Details