Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mitochondrial uncoupling protein 3 (Ucp3)

This Recombinant Rat Mitochondrial uncoupling protein 3 (Ucp3) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 3, UCP 3, Solute carrier family 25 member 9

UniProt

P56499

Expression Region

1-308

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGLQPSEVPPTTVVKFLGAGTAACFADLLTFPLDTAKVRLQIQGENPGVQSVQYRGVLG TILTMVRTEGPRSPYSGLVAGLHRQMSFASIRIGLYDSVKQFYTPKGTDHSSVAIRILAG CTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWP NITRNAIVNCAEMVTYDIIKEKLLDSHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTR YMNAPPGRYRSPLHCMLRMVAQEGPTAFYKGFMPSFLRLGSWNVMMFVTYEQLKRALMKV QVLRESPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9- ([1,1':3',1''-Terphenyl]-5'-yl) -10-bromoanthracene
OR90360-01 250 mg

9- ([1,1':3',1''-Terphenyl]-5'-yl) -10-bromoanthracene

Sign In for Pricing
View Details
9- ([1,1':3',1''-Terphenyl]-5'-yl) -10-bromoanthracene
OR90360-02 1 g

9- ([1,1':3',1''-Terphenyl]-5'-yl) -10-bromoanthracene

Sign In for Pricing
View Details
9- ([1,1':3',1''-Terphenyl]-5'-yl) -10-bromoanthracene
OR90360-03 5 g

9- ([1,1':3',1''-Terphenyl]-5'-yl) -10-bromoanthracene

Sign In for Pricing
View Details
9- ([1,1':3',1''-Terphenyl]-5'-yl) -10-bromoanthracene
OR90360-04 25 g

9- ([1,1':3',1''-Terphenyl]-5'-yl) -10-bromoanthracene

Sign In for Pricing
View Details
FLJ43980 (NM_001004299) Human Tagged Lenti ORF Clone
RC209893L4 10 µg

FLJ43980 (NM_001004299) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Bovine coronavirus Non-structural protein 2a (2a)
RPC27982-01 20 µg

Recombinant Bovine coronavirus Non-structural protein 2a (2a)

Sign In for Pricing
View Details