Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial uncoupling protein 3 (Ucp3)

This Recombinant Mouse Mitochondrial uncoupling protein 3 (Ucp3) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 3, UCP 3, Solute carrier family 25 member 9

UniProt

P56501

Expression Region

1-308

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGLQPSEVPPTTVVKFLGAGTAACFADLLTFPLDTAKVRLQIQGENPGAQSVQYRGVLG TILTMVRTEGPRSPYSGLVAGLHRQMSFASIRIGLYDSVKQFYTPKGADHSSVAIRILAG CTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWP NITRNAIVNCAEMVTYDIIKEKLLESHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTR YMNAPLGRYRSPLHCMLKMVAQEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKRALMKV QVLRESPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA9E Protein Vector (Human) (pPB-C-His)
PV079317 500 ng

FRA9E Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Human PIBF (Progesterone-induced-blocking factor) ELISA Kit
MBS2516289-01 24 Tests (Limit 1)

Human PIBF (Progesterone-induced-blocking factor) ELISA Kit

Sign In for Pricing
View Details
Human PIBF (Progesterone-induced-blocking factor) ELISA Kit
MBS2516289-02 48 Tests

Human PIBF (Progesterone-induced-blocking factor) ELISA Kit

Sign In for Pricing
View Details
Human PIBF (Progesterone-induced-blocking factor) ELISA Kit
MBS2516289-03 96 Tests

Human PIBF (Progesterone-induced-blocking factor) ELISA Kit

Sign In for Pricing
View Details
Human PIBF (Progesterone-induced-blocking factor) ELISA Kit
MBS2516289-04 5x 96 Tests

Human PIBF (Progesterone-induced-blocking factor) ELISA Kit

Sign In for Pricing
View Details
Human PIBF (Progesterone-induced-blocking factor) ELISA Kit
MBS2516289-05 10x 96 Tests

Human PIBF (Progesterone-induced-blocking factor) ELISA Kit

Sign In for Pricing
View Details