Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial uncoupling protein 3 (Ucp3)

This Recombinant Mouse Mitochondrial uncoupling protein 3 (Ucp3) spans the amino acid sequence from region 1-308.

Product Specifications

Product Name Alternative

Mitochondrial uncoupling protein 3, UCP 3, Solute carrier family 25 member 9

UniProt

P56501

Expression Region

1-308

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGLQPSEVPPTTVVKFLGAGTAACFADLLTFPLDTAKVRLQIQGENPGAQSVQYRGVLG TILTMVRTEGPRSPYSGLVAGLHRQMSFASIRIGLYDSVKQFYTPKGADHSSVAIRILAG CTTGAMAVTCAQPTDVVKVRFQAMIRLGTGGERKYRGTMDAYRTIAREEGVRGLWKGTWP NITRNAIVNCAEMVTYDIIKEKLLESHLFTDNFPCHFVSAFGAGFCATVVASPVDVVKTR YMNAPLGRYRSPLHCMLKMVAQEGPTAFYKGFVPSFLRLGAWNVMMFVTYEQLKRALMKV QVLRESPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VN2R6P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV789774 1.0 µg DNA

VN2R6P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Z-Trp-Val-OH trifluoroacetic acid
FT111520 2 g

Z-Trp-Val-OH trifluoroacetic acid

Sign In for Pricing
View Details
MRPS30 Protein Vector (Rat) (pPB-N-His)
PV283291 500 ng

MRPS30 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
GFAP Antibody
orb43801 0.1 mg

GFAP Antibody

Sign In for Pricing
View Details
IRG1 ORF Vector (Human) (pORF)
ORF021973 1.0 µg DNA

IRG1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human Protein RIC-3 (RIC3), partial
MBS1280844-01 0.5 mg (E-Coli)

Recombinant Human Protein RIC-3 (RIC3), partial

Sign In for Pricing
View Details